Agromyces archimandritae: G127AT_01070
Help
Entry
G127AT_01070 CDS
T08034
Name
(GenBank) M56 family metallopeptidase
KO
K02172
bla regulator protein blaR1
Organism
aarc
Agromyces archimandritae
Pathway
aarc01501
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:
aarc00001
]
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
G127AT_01070
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
aarc01002
]
G127AT_01070
09183 Protein families: signaling and cellular processes
01504 Antimicrobial resistance genes [BR:
aarc01504
]
G127AT_01070
Peptidases and inhibitors [BR:
aarc01002
]
Metallo peptidases
Family M56
G127AT_01070
Antimicrobial resistance genes [BR:
aarc01504
]
Gene sets
beta-Lactam resistance modules
beta-Lactam resistance, Bla system [MD:
M00627
]
G127AT_01070
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_M48
Peptidase_M56
Motif
Other DBs
NCBI-ProteinID:
QTX04887
UniProt:
A0A975FN24
LinkDB
All DBs
Position
218641..219570
Genome browser
AA seq
309 aa
AA seq
DB search
MTQIAAVLGVIAIALAWPAPILLARAEWPARAPATALALWQAIAVAGGLSMLGSLLAFAL
SAAGTGLGGLLTLGPELWAGPIPEGFGVFHLAALTLAVVLGGHLLLNLATTAVAAERQRR
RQHRLLGLLSDPLPGPGRARVLAHPAPVAYCVPGMRTATVLTDGLVALLEPRELAAVIAH
ERMHLTGLHHLILLAFRAWHGALPWFPIANRAERAVTLLTEYLADDAAARRVGAATIRQA
LARVGADGEPGAYSEHGGVALDTEMLGRRLARLGDEPRTELDAGARGAIFAGSLLLVAVP
TFLIALSVI
NT seq
930 nt
NT seq
+upstream
nt +downstream
nt
atgacccagatcgccgccgtcctcggcgtgatcgccatcgcgctggcctggccggcgccg
atcctgctcgcccgcgccgaatggcccgcacgcgcgccggcgaccgccctcgccctctgg
caggcgatcgccgtcgccggcgggctctcgatgctcggctcgctcctggccttcgccctc
tccgccgccggcaccggcctcggcggcctcctcaccctcggccccgaactctgggccggc
cccatccccgagggcttcggcgtcttccacctcgccgccctcaccctcgccgtcgtcctc
ggcggccacctgctgctgaacctcgcgaccacggccgtcgccgccgaacgccagcgccgc
cgccagcaccgcctcctcggcctgctctccgacccgctgcccgggcccggccgcgcgcgg
gtgctggcgcatccggcccccgtggcctactgcgtgcccggcatgcgcaccgcgaccgtg
ctcaccgacgggctcgtcgccctcctcgaaccccgcgaactggccgccgtcatcgcgcac
gagcgcatgcacctgaccgggctgcaccacctcatcctgctcgcgttccgcgcctggcac
ggtgcgctgccgtggttccccatcgccaaccgcgccgagcgggccgtgaccctcctcacg
gaatacctcgccgacgacgcggccgcccgtcgcgtcggcgccgccaccatccggcaggct
ctcgcccgcgtcggtgccgacggcgaacccggcgcctactccgagcacggcggcgtcgcc
ctcgacaccgagatgctcggccgccggctcgcccgcctcggcgacgaaccccggaccgag
ctcgacgccggcgccagaggggcgatcttcgccggctcgctcctgctcgtcgccgtcccg
accttcctcatcgcgctcagcgtcatctga
DBGET
integrated database retrieval system