Azospirillum argentinense: D3093_02875 Help Entry D3093_02875       CDS       T08628                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aare  Azospirillum argentinense Pathway aare01100   Metabolic pathways aare01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aare00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D3093_02875    00074 Mycolic acid biosynthesis     D3093_02875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D3093_02875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QCN94292 UniProt:  A0A560C8P4 LinkDB All DBs Position complement(591131..591370) Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVDHLGVEESKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFIKANAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgccgagcgcgttaagaagatcgttgtggaccacctcggggtcgaggag tcgaaggtgacggagaacgcctccttcatcgacgatctcggcgccgacagcctcgacacg gtcgagctggttatggctttcgaggaagagttcggctgcgagattccggacgacgccgct gagaagattctgacggtgaaggacgccatcgacttcatcaaggcgaacgccgccgcctga

DBGET integrated database retrieval system