KEGG   Azospirillum argentinense: D3093_26630
Entry
D3093_26630       CDS       T08628                                 
Name
(GenBank) BON domain-containing protein
Organism
aare  Azospirillum argentinense
SSDB
Motif
Pfam: BON
Other DBs
NCBI-ProteinID: QCN98779
UniProt: A0A4D8PUV5
LinkDB
Position
p2:925632..926939
AA seq 435 aa
MSDYESRWRNDQGARRDDDRWERDRQRGESREWSSGSYQNRGQNRDRDEFGPSNWGQSGS
SQFGSGQAGRSGMMGGGGRQPGYGYEGQGREGYDYGRDYWRQQEGRGDYGQGSYGQNYGQ
GSGSRDYGRSDYGRDYGSRGSFGQGQRDWRSRDDRQNYEDRGDYGQDFGYRGGFGRSDYG
SGAYGGRDYGSRDYGGMEYGSGSRGYGNRDYSSRDYGNRDYGRMGYGGGSGSGRNEERGF
FERAGDEMASWFGDEDAERRRRMDARNDDPGAQHHRGRGPRGYTRSDDRIREDVNDRLTD
DPYIDASEIDVTVSNSEVTLSGTVGDRRTKRRAEDMAETISGVRHVQNNLRVRERTFGGT
GTTAGASAMAGLGGTGSSGTGMSGSGMGSTGMSGSTTGTSGTSSTSGTGMSGTSGTTDST
SRTSTSGSTTGSTTR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtccgactatgaatccaggtggaggaacgaccagggcgcccgccgtgacgacgaccgg
tgggagcgcgaccgccaacgcggcgaaagccgcgagtggagctccggttcgtatcagaac
cgtggccagaaccgtgaccgtgacgagttcggtccgtcgaattggggccagtccggctcg
agccaattcggatccggtcaggccggccgctccggcatgatgggcggcggtggccgccag
cccggctacggctacgagggtcagggccgcgaaggctatgactatggccgtgactattgg
cgccaacaggaaggccggggcgattacggtcaaggctcctatggtcagaactacggccaa
ggctccggcagccgcgactacggccgctccgattacggccgcgattacgggtcccgcggc
tccttcggtcagggccagcgcgactggcgctcccgcgatgatcgccagaattatgaggac
cgtggcgactacggccaggacttcggttaccgcgggggcttcggccgctccgattacggc
agcggagcttacggcggccgggactatggcagccgcgactacggcggcatggagtacggg
tccgggtcccgcggctatggaaaccgggactacagcagccgtgactacggcaaccgcgac
tacggccggatgggctatggcggcggcagcggctccggccgcaacgaggagcgcggcttc
ttcgaacgggcgggcgacgagatggcctcctggttcggcgacgaggacgccgaacgccgc
cgccgcatggacgcccgcaacgacgatcccggcgcccagcaccatcggggccgcgggccg
cgcggctacacccgctccgacgaccgcatccgcgaggatgtgaacgaccggctgaccgac
gatccctacatcgacgcgtcggaaatcgacgtgaccgtcagcaacagcgaggtcacgctg
agcggtacggtgggcgatcgccggaccaagcgccgcgccgaggacatggccgagaccatc
tccggcgtccgccacgttcagaacaacctgcgcgtccgtgagcggaccttcggcggcacc
ggcaccaccgccggggcgtcggcaatggccgggctcggcggcaccgggtcttccggcacc
ggcatgagcggctcggggatgggcagcaccggcatgagcgggtccacaacgggcacgtcc
ggaacctccagcacctccgggaccggcatgagcgggacctccggaaccacggacagcacc
agccgcaccagcacctccggcagcaccacgggcagcaccacccgctga

DBGET integrated database retrieval system