Azospirillum argentinense: D3093_26630
Help
Entry
D3093_26630 CDS
T08628
Name
(GenBank) BON domain-containing protein
Organism
aare
Azospirillum argentinense
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BON
Motif
Other DBs
NCBI-ProteinID:
QCN98779
UniProt:
A0A4D8PUV5
LinkDB
All DBs
Position
p2:925632..926939
Genome browser
AA seq
435 aa
AA seq
DB search
MSDYESRWRNDQGARRDDDRWERDRQRGESREWSSGSYQNRGQNRDRDEFGPSNWGQSGS
SQFGSGQAGRSGMMGGGGRQPGYGYEGQGREGYDYGRDYWRQQEGRGDYGQGSYGQNYGQ
GSGSRDYGRSDYGRDYGSRGSFGQGQRDWRSRDDRQNYEDRGDYGQDFGYRGGFGRSDYG
SGAYGGRDYGSRDYGGMEYGSGSRGYGNRDYSSRDYGNRDYGRMGYGGGSGSGRNEERGF
FERAGDEMASWFGDEDAERRRRMDARNDDPGAQHHRGRGPRGYTRSDDRIREDVNDRLTD
DPYIDASEIDVTVSNSEVTLSGTVGDRRTKRRAEDMAETISGVRHVQNNLRVRERTFGGT
GTTAGASAMAGLGGTGSSGTGMSGSGMGSTGMSGSTTGTSGTSSTSGTGMSGTSGTTDST
SRTSTSGSTTGSTTR
NT seq
1308 nt
NT seq
+upstream
nt +downstream
nt
atgtccgactatgaatccaggtggaggaacgaccagggcgcccgccgtgacgacgaccgg
tgggagcgcgaccgccaacgcggcgaaagccgcgagtggagctccggttcgtatcagaac
cgtggccagaaccgtgaccgtgacgagttcggtccgtcgaattggggccagtccggctcg
agccaattcggatccggtcaggccggccgctccggcatgatgggcggcggtggccgccag
cccggctacggctacgagggtcagggccgcgaaggctatgactatggccgtgactattgg
cgccaacaggaaggccggggcgattacggtcaaggctcctatggtcagaactacggccaa
ggctccggcagccgcgactacggccgctccgattacggccgcgattacgggtcccgcggc
tccttcggtcagggccagcgcgactggcgctcccgcgatgatcgccagaattatgaggac
cgtggcgactacggccaggacttcggttaccgcgggggcttcggccgctccgattacggc
agcggagcttacggcggccgggactatggcagccgcgactacggcggcatggagtacggg
tccgggtcccgcggctatggaaaccgggactacagcagccgtgactacggcaaccgcgac
tacggccggatgggctatggcggcggcagcggctccggccgcaacgaggagcgcggcttc
ttcgaacgggcgggcgacgagatggcctcctggttcggcgacgaggacgccgaacgccgc
cgccgcatggacgcccgcaacgacgatcccggcgcccagcaccatcggggccgcgggccg
cgcggctacacccgctccgacgaccgcatccgcgaggatgtgaacgaccggctgaccgac
gatccctacatcgacgcgtcggaaatcgacgtgaccgtcagcaacagcgaggtcacgctg
agcggtacggtgggcgatcgccggaccaagcgccgcgccgaggacatggccgagaccatc
tccggcgtccgccacgttcagaacaacctgcgcgtccgtgagcggaccttcggcggcacc
ggcaccaccgccggggcgtcggcaatggccgggctcggcggcaccgggtcttccggcacc
ggcatgagcggctcggggatgggcagcaccggcatgagcgggtccacaacgggcacgtcc
ggaacctccagcacctccgggaccggcatgagcgggacctccggaaccacggacagcacc
agccgcaccagcacctccggcagcaccacgggcagcaccacccgctga
DBGET
integrated database retrieval system