Amedibacterium intestinale JCM 30884: Aargi30884_07180 Help Entry Aargi30884_07180  CDS       T06426                                  Name (GenBank) hypothetical protein   KO K03111   single-strand DNA-binding protein Organism aarg  Amedibacterium intestinale JCM 30884 Pathway aarg03030   DNA replication aarg03430   Mismatch repair aarg03440   Homologous recombination Brite KEGG Orthology (KO) [BR:aarg00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Aargi30884_07180    03430 Mismatch repair     Aargi30884_07180    03440 Homologous recombination     Aargi30884_07180  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aarg03032]     Aargi30884_07180    03400 DNA repair and recombination proteins [BR:aarg03400]     Aargi30884_07180    03029 Mitochondrial biogenesis [BR:aarg03029]     Aargi30884_07180 DNA replication proteins [BR:aarg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Aargi30884_07180 DNA repair and recombination proteins [BR:aarg03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Aargi30884_07180   TLS (translesion DNA synthesis) factors    Other SOS response factors     Aargi30884_07180 Mitochondrial biogenesis [BR:aarg03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Aargi30884_07180 SSDB OrthologParalogGFIT Motif Pfam:  SSB OSB_SSB YorF tRNA_anti-codon Motif Other DBs NCBI-ProteinID:  BBK21815 UniProt:  A0A6N4THB1 LinkDB All DBs Position complement(702767..703087) Genome browser AA seq 106 aa AA seqDB search MNLIVFVGKIKEIPVLKESTHGNTYATMKIEVTRPFANSEGVYETDEFSVTLWKGIAQTT VQVAGEGDVVAIKGRMQSRPYETKDGTTYLSYDIIAEKVSFIGKEG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgaatttaatagtatttgtaggaaaaataaaagaaattcctgtattgaaagaatctact catgggaatacgtatgccacaatgaaaattgaggttacacgtccttttgccaacagtgaa ggtgtttatgaaacggatgaattttctgtaacactttggaaaggtattgcacaaactacg gttcaagttgcaggagagggagatgttgtcgcaataaaaggcagaatgcagtcgcgtcct tatgaaacaaaggatggtacaacgtatttaagttatgatattattgcagagaaagtatct tttattggaaaagaaggataa

DBGET integrated database retrieval system