Acetobacter ascendens: A4S02_03825 Help Entry A4S02_03825       CDS       T05523                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aasc  Acetobacter ascendens Pathway aasc01100   Metabolic pathways aasc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aasc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A4S02_03825    00074 Mycolic acid biosynthesis     A4S02_03825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A4S02_03825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AOW46048 UniProt:  A0A1D8QUP8 LinkDB All DBs Position complement(792452..792691) Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVEESKVTPDASFIDDLGADSLDTVELVMAFEEAFNVEIPEDAA EKITTVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgctgataaggttaagaaaatcgtggtcgagcatctcggcgtcgaggaa agcaaggtcacaccggatgcatcgttcatcgatgacctgggcgctgacagccttgatacc gttgagctggtgatggcgtttgaagaagccttcaatgtcgaaatcccggaagatgcagcg gaaaaaatcaccaccgttaaagatgctatcgattacatcgaaaagcagaaagctgcctga

DBGET integrated database retrieval system