KEGG   Actinokineospora auranticolor: V5P93_000365
Entry
V5P93_000365      CDS       T10991                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
aaur  Actinokineospora auranticolor
Pathway
aaur02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aaur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    V5P93_000365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaur02000]
    V5P93_000365
Enzymes [BR:aaur01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     V5P93_000365
Transporters [BR:aaur02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    V5P93_000365
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_29 AAA_30 AAA_27 AAA_33 AAA_16 FtsK_SpoIIIE NACHT AAA_19 RsgA_GTPase
Other DBs
NCBI-ProteinID: XGP72933
LinkDB
Position
complement(356390..357223)
AA seq 277 aa
MISYDRQAGGSRPLPACPTPPEQQLTPLDTALSVSGLRKSYGDRQVLKGVDFAVAPGELV
VLLGANGSGKSTALRCVVGLAEADAGEIRLAGRRLRGLGGAELAKARRAAAMVFQQIHLV
RRRSALDNVCAGGLAGLPLSRSLAPAFFPRELRERAMACLQRVGLADRAHDRAGSLSGGQ
QQRVAVARALCQGAEVLLADEPVSALDPAAATQVMALLAELARRDGLAVAAVLHQPDLAR
EHADRVIGLVDGEIRLSCHASALSESDIDALYQSEDS
NT seq 834 nt   +upstreamnt  +downstreamnt
gtgatctcctacgaccggcaggcgggagggtccaggcccctccccgcctgccccactcct
cccgagcagcagctgaccccgttggacaccgcgctctcggtgagcgggctgcgcaagtcc
tacggcgaccggcaggtgctcaagggcgtcgacttcgcggtcgcgcccggcgagctggtg
gtcctgttgggcgccaacgggtccggcaagtcgacggcgctgcgctgcgtcgtggggctg
gccgaggcggacgcgggtgagatccggctggccgggcggcggctgcgcgggctcggcggt
gccgagctggccaaggcgcggcgcgcggcggccatggtcttccagcagatccacctggtg
cgcaggcgaagcgcgctggacaacgtgtgcgcgggcgggctcgccgggctgccgctgtcg
cggtcgctggcccccgcgttcttcccgcgcgagttgcgggagcgcgcgatggcgtgcctg
caacgggtagggctcgccgaccgcgcgcacgaccgggcggggagcctgtccggcgggcag
cagcagcgggtcgccgtggcgcgggcgttgtgccagggggccgaggtgctgctggccgac
gagccggtgtccgctctggacccggccgccgcgacccaggtcatggcgctgctggcggaa
ctcgcgcggcgcgacgggttggcggtggcggccgtgctgcaccagccggacctggcgcgc
gagcacgcggaccgggtgatcgggttggtcgacggcgagatccgcttgtcctgccacgct
tccgcactgtccgaatcggacatcgatgcgctctaccagtcggaggactcgtga

DBGET integrated database retrieval system