Paracidovorax citrulli: Aave_1186 Help Entry Aave_1186         CDS       T00451                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aav  Paracidovorax citrulli Pathway aav00998   Biosynthesis of various antibiotics aav01100   Metabolic pathways aav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Aave_1186    00074 Mycolic acid biosynthesis     Aave_1186   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Aave_1186 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ABM31778 UniProt:  A1TLE0 LinkDB All DBs Position 1306795..1307034 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcatcgccgaacaactcggcgtggaagag tcgcaagtcaccaatgaaaaggccttcgtggccgacctgggtgccgactccctcgacacg gtggagctggtgatggcgctggaagacgagttcggcatcgagatccctgacgaagacgca gagaagatcacgacggtgcagaacgccatcgactacgcgaacacccaccagaaggcctga

DBGET integrated database retrieval system