Paracidovorax citrulli: Aave_3244
Help
Entry
Aave_3244 CDS
T00451
Name
(GenBank) conserved hypothetical protein
KO
K03646
colicin import membrane protein
Organism
aav
Paracidovorax citrulli
Brite
KEGG Orthology (KO) [BR:
aav00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
aav02000
]
Aave_3244
Transporters [BR:
aav02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
Aave_3244
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
ABM33806
UniProt:
A1TS68
LinkDB
All DBs
Position
complement(3580840..3581592)
Genome browser
AA seq
250 aa
AA seq
DB search
MTNSSLPSLLRALALAVSWALLTVAGPVAAAAAQGDAEQARAAFEAAQAARTAERARIQE
ERAALDARKKKEEAVCYQRFSVESCLGTVRSQVRDAEAVLRKREVELNNAERREKAALRM
QSIEQKQAEQRQKIESGERPAPMRAESRSRAQPEDRAQREEEARSRAAQQRAREESHRNA
EAERAATQPARSAEARARYEAKQRAARERREKRERANAEAAASGRKPAAPLPDPADPAPP
SAPAGSAPAR
NT seq
753 nt
NT seq
+upstream
nt +downstream
nt
atgacgaactcttcactgccttcccttctccgcgccctcgccctggcggtgtcctgggcg
ctgctgaccgttgccggcccggtggcggcggccgcagcccagggcgatgccgagcaggcc
cgtgccgcgttcgaggccgcgcaggcggccaggaccgcggagcgcgcgcgcatccaggaa
gagcgggccgcgctcgatgcgcgcaagaagaaggaggaggcggtctgctaccagcgcttt
tccgtggaatcctgcctgggaacggtgcgctcccaggtgcgcgatgcggaggcggtgctg
cgcaagcgggaggtggaactgaacaacgcggagcggcgcgagaaagccgccctgcggatg
cagtccatcgagcagaagcaggccgagcagcgccagaagatcgaaagcggggaacgcccg
gcgcccatgcgcgccgagtcgcggtcccgggcccagcccgaggaccgcgcgcagcgcgag
gaagaggcgcgctcgcgtgcggcccagcagcgcgcgcgcgaggaatcccaccgcaacgcc
gaggccgagcgcgccgccacgcagccggcccgttccgccgaggcgcgggcgcgctacgag
gccaagcagcgggccgcccgggagcgccgggaaaagcgcgaacgcgccaatgccgaggcc
gcggcctcgggccgcaagcccgcggctcccttgccggacccggccgatcccgcccccccg
tcggcgcctgccggttccgcgccggcccgctga
DBGET
integrated database retrieval system