Alteromonas stellipolaris R10SW13: AVL56_02635 Help Entry AVL56_02635       CDS       T04403                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism aaw  Alteromonas stellipolaris R10SW13 Pathway aaw01100   Metabolic pathways aaw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aaw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AVL56_02635    00074 Mycolic acid biosynthesis     AVL56_02635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AVL56_02635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding_2 PP-binding Ribosomal_L50 FAS_N FANCI_S1 NUP160_helical_2 Motif Other DBs NCBI-ProteinID:  AMJ93306 LinkDB All DBs Position complement(607115..607378) Genome browser AA seq 87 aa AA seqDB search MGLDTVEIVLWAEEKFGVEMPDEEVTNICTVGEFANYIASKVNNEKGTNISFEEVMPDLL DVLEADYSVPRHKITLDSRFVQDLGFG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgggcttagatactgtagaaatcgtattgtgggctgaagagaagtttggtgtagaaatg ccggatgaagaagttactaatatctgtactgtcggagagtttgctaattacattgccagt aaagttaataacgaaaaaggcaccaacatcagctttgaggaagtaatgccggatctgctc gatgtgctggaggcggactatagtgtgccaagacataaaatcactttagatagtcggttt gtccaagatctaggttttggttag

DBGET integrated database retrieval system