Alteromonas stellipolaris R10SW13: AVL56_17410
Help
Entry
AVL56_17410 CDS
T04403
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
aaw
Alteromonas stellipolaris R10SW13
Pathway
aaw03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
aaw00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
AVL56_17410
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
aaw03011
]
AVL56_17410
Ribosome [BR:
aaw03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
AVL56_17410
Bacteria
AVL56_17410
Archaea
AVL56_17410
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
AMJ96658
LinkDB
All DBs
Position
complement(4086466..4086819)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKTARIRRATRARAKIRELAAHRLVINRTPRHIYAQLIAPSGSEVLAAASTVDKELAK
DLKSTGNAEAAAIVGKAIAERAKEKGIEKVAFDRSGFKYHGRVKALADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaaacagctcgcattcgtcgcgctacacgcgcacgagcaaaaattcgtgaa
ctggccgcgcatcgcttggtaattaaccgtacacctcgccacatctatgctcagttaatc
gctcctagcggttctgaagtattagcagcggcttctactgtagataaagaacttgcaaaa
gatcttaagtcaacaggtaacgctgaagcagcggcgatagtcggtaaagcaattgcagaa
cgcgctaaagagaaaggcattgagaaagtggctttcgatcgtagtggttttaaataccac
ggtcgcgttaaggcattagctgatgcagctcgcgaagctggccttcagttctag
DBGET
integrated database retrieval system