Croceibacterium atlanticum: WYH_00801 Help Entry WYH_00801         CDS       T03925                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism aay  Croceibacterium atlanticum Pathway aay01100   Metabolic pathways aay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WYH_00801 (acpP_1)    00074 Mycolic acid biosynthesis     WYH_00801 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WYH_00801 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AKH41854 UniProt:  A0A0F7KQJ4 LinkDB All DBs Position complement(843511..843747) Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEEDKVTPDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKINTVGDANKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgaagaagatcgtcgtcgaacatctcggcgtcgaggaa gacaaggtcacgccggacgccagcttcattgatgatctcggtgccgacagcctcgacatc gtcgaactggtcatggcgttcgaggaagaattcggcgtcgaaattccggacgatgcggcc gagaagatcaacacggttggtgacgccaacaagtatattgaagagcacaagggctaa

DBGET integrated database retrieval system