Croceibacterium atlanticum: WYH_02457 Help Entry WYH_02457         CDS       T03925                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism aay  Croceibacterium atlanticum Pathway aay01100   Metabolic pathways aay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WYH_02457 (acpP_2)    00074 Mycolic acid biosynthesis     WYH_02457 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WYH_02457 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKH43487 UniProt:  A0A0F7KWB4 LinkDB All DBs Position complement(2545321..2545563) Genome browser AA seq 80 aa AA seqDB search MDRAEIDSRIRSLIEPFNKKGIAIADETTFAGDLEFDSLTVMDFVAAIEDEFDIIISMNQ QAEIETYGQLVSAVSDLQDK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatcgcgccgaaatcgacagccgcatccgttcgttgatcgaacccttcaacaagaag ggaatcgcgatcgcggacgagacgactttcgccggtgacctggaattcgacagtctgacg gtgatggatttcgtcgccgcgattgaagacgaattcgacatcattatcagcatgaaccag caggccgaaatcgaaacctacgggcagctggtcagcgccgtgagcgatctgcaggacaag tga

DBGET integrated database retrieval system