Croceibacterium atlanticum: WYH_03169 Help Entry WYH_03169         CDS       T03925                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism aay  Croceibacterium atlanticum Pathway aay02020   Two-component system aay02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:aay00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     WYH_03169  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     WYH_03169  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:aay02035]     WYH_03169 Bacterial motility proteins [BR:aay02035]  Flagellar system   Flagellar assembly proteins    Others     WYH_03169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM M_domain Motif Other DBs NCBI-ProteinID:  AKH44188 UniProt:  A0A0F7KV08 LinkDB All DBs Position 3299162..3299458 Genome browser AA seq 98 aa AA seqDB search MNPVDAASLNVTQRLKNGASSPVSRAEAVRPAASEGGRTGAAVTTGLKKTASAGAEAPID VDRVAEIRKAVEEGRYPLVPTRIGDAMIAAGYLLRTKS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaacccggttgacgcggcaagtctgaatgtgactcagcgcctgaaaaacggcgcatcg tcccccgtgtcacgcgcggaagcagtccgtcctgccgccagtgaagggggcaggaccggc gccgccgtgaccaccggcctgaaaaagaccgcatcggcaggagccgaagccccgatcgat gtcgatcgggtcgcggaaatccgcaaggcggtggaagaagggcgttatccgctggtcccg acccgcatcggtgacgccatgattgctgccggttatctgttgaggaccaagtcgtga

DBGET integrated database retrieval system