Anoxybacillus ayderensis: B379_01305 Help Entry B379_01305        CDS       T10145                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aayd  Anoxybacillus ayderensis Pathway aayd01100   Metabolic pathways aayd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aayd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B379_01305 (acpP)    00074 Mycolic acid biosynthesis     B379_01305 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B379_01305 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AXM87917 LinkDB All DBs Position complement(253461..253697) Genome browser AA seq 78 aa AA seqDB search MADVLERVTKIIVDRLGVEESQVTLESSFKEDLGADSLDVVELVMELEDEFDMEISDEEA EKIVTVGDAVNYIKSRLS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtattagagcgtgtaacgaaaatcatcgtagatcgccttggtgtcgaggag tcacaagtgacgcttgaatcttcattcaaagaagatttaggagcagattcgcttgatgtc gttgagcttgttatggagttagaagacgaatttgatatggaaatttcagatgaagaggcg gagaaaattgttactgtcggtgacgcagtaaactacataaaaagccgtctatcataa

DBGET integrated database retrieval system