Aggregatibacter aphrophilus W10433: ADJ80_01255 Help Entry ADJ80_01255       CDS       T04521                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aaz  Aggregatibacter aphrophilus W10433 Pathway aaz01100   Metabolic pathways aaz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aaz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ADJ80_01255    00074 Mycolic acid biosynthesis     ADJ80_01255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ADJ80_01255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7095 Motif Other DBs NCBI-ProteinID:  AKU62488 UniProt:  A0A0K1N110 LinkDB All DBs Position 256904..257167 Genome browser AA seq 87 aa AA seqDB search MELEQQLKQLIIDSLALEDISVEDIENDTALFGDDGLGLDSVDALELGLAVQKTFGLQLD SEQTQLRDHFESVTSLAKFIRAQKGEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaactggaacaacaacttaaacaattaatcattgacagccttgcgttagaagacatc agtgttgaagatattgaaaatgacaccgcactttttggtgacgatggcttaggtttggac tctgttgatgctctcgagcttggtctggccgtacaaaaaacctttggtttgcaattagat agtgaacaaacccaattgcgcgatcattttgaaagcgtcacctccttagccaaatttatt cgagcgcaaaaaggcgaggcataa

DBGET integrated database retrieval system