Aggregatibacter aphrophilus W10433: ADJ80_01390 Help Entry ADJ80_01390       CDS       T04521                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism aaz  Aggregatibacter aphrophilus W10433 Pathway aaz00290   Valine, leucine and isoleucine biosynthesis aaz00650   Butanoate metabolism aaz00660   C5-Branched dibasic acid metabolism aaz00770   Pantothenate and CoA biosynthesis aaz01100   Metabolic pathways aaz01110   Biosynthesis of secondary metabolites aaz01210   2-Oxocarboxylic acid metabolism aaz01230   Biosynthesis of amino acids Module aaz_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine aaz_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:aaz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     ADJ80_01390    00660 C5-Branched dibasic acid metabolism     ADJ80_01390   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     ADJ80_01390   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     ADJ80_01390 Enzymes [BR:aaz01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      ADJ80_01390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT_4 ACT bHLH-TF_ACT-like_plant AraC_N YgbB Motif Other DBs NCBI-ProteinID:  AKU62511 LinkDB All DBs Position 283021..283236 Genome browser AA seq 71 aa AA seqDB search MEHQIELTAQHRPEVLERILRVIRHRGFTVTQMDMQLIDDKVRLKFTVKSDRTLDLLVSQ LEKIYDVVEIK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggaacaccaaatcgaactcaccgcccaacaccgccccgaagtgctcgaacgcattctc cgcgtcatccgccaccgtggtttcaccgtaacccaaatggatatgcaactgattgacgac aaagtgcggttaaaattcaccgtaaaatccgaccgcactttggatttgttggtcagtcag ttggagaaaatttatgatgtggtggagattaaataa

DBGET integrated database retrieval system