Aggregatibacter aphrophilus W10433: ADJ80_02380 Help Entry ADJ80_02380       CDS       T04521                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism aaz  Aggregatibacter aphrophilus W10433 Brite KEGG Orthology (KO) [BR:aaz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aaz03036]     ADJ80_02380 Chromosome and associated proteins [BR:aaz03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ADJ80_02380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Dynamitin Csm1_N Sos7 NUDE_C Motif Other DBs NCBI-ProteinID:  AKU62680 UniProt:  A0A0K1N0R6 LinkDB All DBs Position 487222..487500 Genome browser AA seq 92 aa AA seqDB search MRLFISLLIAVLLLFQYDFWFGKNGYWDYKNTTKEIAVHQQENEKLSQRNQIIAAEIKDL KEGVDAIEERARSQHEMVKPNETFYHIVKEHK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgtttatttatttctttactcattgcggtgttattgctgttccaatatgatttttgg ttcggcaaaaacggttattgggattacaaaaacaccaccaaagaaattgccgtacatcaa caggaaaacgaaaaactttcccaacgaaatcaaattattgccgcagaaatcaaagatctc aaagaaggggtggatgccattgaagaacgggcgcgttcgcaacatgaaatggtgaaacca aacgaaactttctatcacatcgtcaaagaacacaaataa

DBGET integrated database retrieval system