Aggregatibacter aphrophilus W10433: ADJ80_09355
Help
Entry
ADJ80_09355 CDS
T04521
Symbol
uvrD
Name
(GenBank) DNA-dependent helicase II
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
aaz
Aggregatibacter aphrophilus W10433
Pathway
aaz03420
Nucleotide excision repair
aaz03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
aaz00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
ADJ80_09355 (uvrD)
03430 Mismatch repair
ADJ80_09355 (uvrD)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
aaz03400
]
ADJ80_09355 (uvrD)
Enzymes [BR:
aaz01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
ADJ80_09355 (uvrD)
DNA repair and recombination proteins [BR:
aaz03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
ADJ80_09355 (uvrD)
MMR (mismatch excision repair)
Other MMR factors
ADJ80_09355 (uvrD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD_C
UvrD-helicase
AAA_19
PcrA_UvrD_tudor
UvrD_C_2
AAA_30
Viral_helicase1
AAA_12
Motif
Other DBs
NCBI-ProteinID:
AKU63934
UniProt:
A0ABX9VUK2
LinkDB
All DBs
Position
complement(2024103..2026277)
Genome browser
AA seq
724 aa
AA seq
DB search
MDFAELLDGLNDKQREAVSAPLGNYLVLAGAGSGKTRVLTHRIAWLIGVEGVSEGSIMAV
TFTNKAAAEMRHRIESVLSDGNQRLFGMWVGTFHSIAHRLLRAHHLDADLPQDFQILDSE
DQLRLLKRLMKLHHFDEKSFPPKQAAWYINNKKDEGLRPNQIDDHHDRQEREWIRIYQIY
QDACDRAGLVDFAEILLRSYELFLHKPLILQRYQQRFQHILVDEFQDTNKIQYEWIRLLA
GKTGKVMIVGDDDQSIYGWRGAKIENIQLFLKEFANAQTIRLEQNYRSTMNILQAANELI
SNNNNRLGKNLWSEGNQGDPVGIYAAFNELDEALFVSSQIKTWIEDGGKLNDCAILYRSN
SQSRVIEEALIRSQIPYRIYGGMRFFERQEIKDALAYLRLIANRQDDAAFERVINTPPRG
IGDRTLDTLRNLTREHQITLWQATNLALQENKLAGRAATALLRFMELINSLQRDTEEMPL
FAQTDFVIKHSGLYEMYKQEKGEKGEVRIENLEELVSAAREFIKPEESEDMTELTAFLTH
ASLEAGEEQAAPHQACVEMMTLHSAKGLEFPRVFMIGVEEGLFPSFRSFEESGRLEEERR
LAYVGITRAKQKLTISYAESRRLYGKEERHLPSRFITELPQQCLQEIRLRGTVTRALNQA
KVGSVSPIANESEWKMGQKVKHEKFGFGTVINVEGADNNLRLQIAFQNQGIKWLIAHLAK
LEKI
NT seq
2175 nt
NT seq
+upstream
nt +downstream
nt
atggatttcgcagaattattagatggcttaaacgataaacaacgggaagcggtgagtgcg
ccgttgggcaattatttggtgttggccggcgcagggagtggtaaaacccgcgtattgacg
caccgaatcgcatggttgattggcgttgaaggtgtctccgaagggagcattatggcggtg
accttcaccaacaaagccgccgcagaaatgcgtcatcgtattgaatccgtcttgtccgac
ggcaatcagcggttatttggtatgtgggtcggtacctttcacagtattgcgcatcgactt
ctgcgcgcccaccatcttgatgcggatttaccgcaagatttccagattttagattcggaa
gaccaattgcgtttactcaaacgcctgatgaaattacatcattttgacgaaaaaagtttc
ccgccaaaacaagccgcttggtatatcaacaataaaaaagacgaaggcttgcgtccgaat
caaattgatgatcatcacgatcgtcaagagcgtgaatggattcggatttatcagatttat
caagatgcttgcgatcgtgcagggctggtggattttgccgaaattttattgcgctcgtac
gaattgtttttacataaaccactgattttgcaacgttaccaacaacgttttcagcatatt
ttggtggatgagtttcaagacaccaacaaaattcaatatgaatggattcgtttgttggcg
ggcaaaaccggcaaagtgatgattgtgggggatgatgaccaatctatttatggctggcgc
ggtgcaaaaattgaaaatattcagttatttttaaaagagtttgccaatgcacaaaccatt
cgattggagcaaaattaccgttccaccatgaatattttgcaggctgctaatgagttaatt
tctaataacaacaaccgactagggaaaaatttgtggtcggaaggaaatcaaggcgatcct
gtaggcatttatgcggcttttaacgaattggatgaagccttgttcgtttcctcgcagatt
aagacttggattgaagacggcggcaaactcaacgattgtgccattttatatcgcagtaac
agtcaatcacgggtgattgaggaagcgttaattcgttcacaaattccttatcgtatttat
ggtggcatgcgcttcttcgaacgtcaggaaatcaaggatgcattggcctatttgcgcttg
attgctaatcgccaagacgatgccgcctttgagcgcgttattaatacgccaccacggggc
attggtgatcgcacgttggacaccttgcgtaatctgactcgcgaacatcaaatcacatta
tggcaagccacaaatttggcattgcaggaaaataaactggcaggtcgtgccgcgaccgcc
ttgcttcgctttatggaattaatcaattctctgcaacgggatacggaagaaatgccattg
tttgcacaaacggattttgtcattaagcattccggtttgtatgaaatgtataaacaggaa
aagggcgaaaaaggcgaagtgcgtattgaaaacttggaagagttggtctctgccgcccgc
gaatttatcaagcctgaagagtcggaagacatgacagagctcacagctttcttgacgcac
gcctcattagaagcgggcgaagaacaagcagcaccgcatcaagcctgtgtagaaatgatg
accttgcactcggcaaaaggcttggagtttcctcgggtgtttatgattggcgtggaagaa
ggattattcccaagtttccgctcttttgaagaatcagggcgtttggaagaagaacgtcgt
ttggcttatgtggggattacccgcgccaaacaaaaacttaccatttcttatgcggaaagt
cgtcgtttatatggcaaagaagaacgccatttgccttcccgttttatcacggaattacca
caacaatgtttgcaggaaatccgtttacgcggcaccgttacccgcgccttaaatcaagcc
aaagtaggcagtgtttcgccgattgccaatgaaagcgaatggaaaatggggcaaaaagtg
aaacacgaaaaatttggttttggcacagtgattaatgtggaaggtgcggacaataatttg
cgcttacaaattgcgttccagaatcaaggaattaaatggctgatcgcccatttggcgaag
ttggagaaaatataa
DBGET
integrated database retrieval system