Candidatus Koribacter versatilis: Acid345_4505 Help Entry Acid345_4505      CDS       T00352                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aba  Candidatus Koribacter versatilis Pathway aba01100   Metabolic pathways aba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Acid345_4505    00074 Mycolic acid biosynthesis     Acid345_4505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Acid345_4505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ABF43505 UniProt:  Q1IHZ5 LinkDB All DBs Position 5347178..5347423 Genome browser AA seq 81 aa AA seqDB search MASVEEKVKQIIVEQLGVDEGEVTPNASFVDDLGADSLDTVELVMAFEEAFEIEIPDEDA EKIRTVKDAVDYITAHAKGGK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcttccgtagaagaaaaagtaaaacagatcattgtcgagcagctcggtgtggatgag ggtgaggttacgcccaatgcttcgttcgtggacgatctcggcgccgactcgctcgatacg gtcgagctggtgatggctttcgaggaagcgtttgaaatcgagattccagatgaggacgcc gaaaagatccgcaccgtaaaagacgcggtagattacatcacagcccacgcgaaaggtggc aagtag

DBGET integrated database retrieval system