Suicoccus acidiformans: CL176_05200 Help Entry CL176_05200       CDS       T05652                                  Name (GenBank) chorismate mutase   KO K04516   chorismate mutase [EC:5.4.99.5] Organism abae  Suicoccus acidiformans Pathway abae00400   Phenylalanine, tyrosine and tryptophan biosynthesis abae01100   Metabolic pathways abae01110   Biosynthesis of secondary metabolites abae01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:abae00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     CL176_05200 Enzymes [BR:abae01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      CL176_05200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Lge1 ZYG-11_interact baeRF_family5 Motif Other DBs NCBI-ProteinID:  AXY25443 UniProt:  A0A347WK36 LinkDB All DBs Position 1102173..1102457 Genome browser AA seq 94 aa AA seqDB search MNLRSLEELREEINQIDTELTKLIEARFKCAVEVAQYKQAHDLPVFDEKREAIVLERNVS AVSDTRFEDDIRRFYQSLMDISKDIQRQELQAEE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttgaatttgcgaagtcttgaggaattacgagaagaaattaatcaaattgatacagaacta actaaactaattgaagcacgctttaagtgtgccgttgaagttgcccagtataagcaggcg catgacttgccggtctttgatgagaaacgggaagccattgttcttgagcggaatgtttcg gccgtgagtgatacacgctttgaagatgatattcggcgtttctatcaaagtttgatggac atttccaaggatattcagcgacaagagttgcaggcggaagaatga

DBGET integrated database retrieval system