KEGG   Candidatus Nanopelagicus limnae: B1s21122_04080
Entry
B1s21122_04080    CDS       T05073                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
abam  Candidatus Nanopelagicus limnae
Pathway
abam00770  Pantothenate and CoA biosynthesis
abam01100  Metabolic pathways
abam01240  Biosynthesis of cofactors
Module
abam_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:abam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    B1s21122_04080
Enzymes [BR:abam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     B1s21122_04080
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig HcgB ATP-sulfurylase
Other DBs
NCBI-ProteinID: ASY09512
UniProt: A0A249JYC8
LinkDB
Position
469888..470370
AA seq 160 aa
MRRVVCPGSFDPITNGHLDIIARACTLFDEVVIAVLVNQTKSSLFTVDERIAMIKEVTAR
YSNVKVDSWSGLLVDYCRTNKIPTIVKGLRAVSDFDYELQMSQVNLQLQGVETLFMSTAP
SHSFLSSSLVKEIASYGGDVSAYMPAAIVDKLKSRVKRRD
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagacgcgttgtttgtcccggttcttttgatccaattactaatggacacctagatatt
atcgccagagcctgcaccttatttgatgaagttgttattgcagtattagttaatcaaacc
aaaagctcactattcacagttgatgagcgaattgccatgattaaagaggttactgctaga
tacagcaatgtgaaggttgattcttggagtggtttattagttgattactgtcgaacaaat
aagattccaacaatagttaaaggattaagagcagtaagtgattttgattatgaactgcag
atgagccaagtaaatctacaactgcaaggggttgagaccttatttatgtctactgctcct
tcgcactcatttttgtcctcctccttggtcaaggagatagcaagttatggtggggatgtt
tcggcgtatatgcctgctgctatcgtcgataagttaaaatcaagagtcaagcggagggat
tag

DBGET integrated database retrieval system