Acidisarcina polymorpha: ACPOL_1403 Help Entry ACPOL_1403        CDS       T05576                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism abas  Acidisarcina polymorpha Pathway abas01100   Metabolic pathways abas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACPOL_1403    00074 Mycolic acid biosynthesis     ACPOL_1403   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACPOL_1403 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Spore_YunB Motif Other DBs NCBI-ProteinID:  AXC10751 UniProt:  A0A2Z5FV65 LinkDB All DBs Position 1455632..1455859 Genome browser AA seq 75 aa AA seqDB search MESVILTYTVKDGPIKITEGTNLSENLGINSARMVDIVLDLEDKFKISIPDSDMEQMNTV GEIVTLIYSLCNGAS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtggaaagcgtcattctgacttacacggttaaagatggtccaataaagatcactgaagga accaacctgtctgagaatttaggtattaattctgcgcgtatggttgatatcgtgttggat cttgaagataagttcaaaatttcaattcctgattcggacatggaacaaatgaataccgtt ggagaaattgtcacactcatctattcactgtgcaatggagcatcgtga

DBGET integrated database retrieval system