Georhizobium profundi: D5400_16405
Help
Entry
D5400_16405 CDS
T05798
Name
(GenBank) AEC family transporter
KO
K13936
malonate transporter and related proteins
Organism
abaw
Georhizobium profundi
Brite
KEGG Orthology (KO) [BR:
abaw00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
abaw02000
]
D5400_16405
Transporters [BR:
abaw02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
D5400_16405
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Mem_trans
Motif
Other DBs
NCBI-ProteinID:
AZN72641
UniProt:
A0A3Q8XPZ4
LinkDB
All DBs
Position
complement(3382750..3383712)
Genome browser
AA seq
320 aa
AA seq
DB search
MPPFVETILFIFALIVIGYGAAALGLLKAQTGEGLSTFVVSVALPMLLFRTLLAADFGSG
LPWGLWIAYFSGIAVTWTLGHITIRQVFGRDARAGVVAGVTSAFANLVLLGLPLIAGIYG
PEGLLLLSLIISIHLVILMAVSMLLFEWAQHKDGVSKGSIGIVAFVRSFGLQLIRNPLIV
GILCGLIGRLIGLELPSLGSRLVNSLADIAAPLALFAMGMSLRNFGLAGHLMPAAALTFL
KLMVMPTVVLVMALILDLPPLTAQVAVVSASMPAGVNSWLIANKFNTGQRLASTAMTMST
PLAVLSTLFWVFVAAHVFGG
NT seq
963 nt
NT seq
+upstream
nt +downstream
nt
atgccgcccttcgtcgagacgatccttttcatctttgcccttatcgtcatcggttatggt
gcggccgctctcggtcttttgaaagcccagacgggcgaggggctcagcaccttcgtcgtc
tccgtcgctctgccgatgcttctcttcagaacgctgctcgcagccgacttcggctccggt
ctgccctgggggctgtggatcgcctatttctcaggaattgccgtcacctggacgcttggg
cacatcaccatccgtcaggtgttcgggcgagacgcacgggcaggcgtcgtggccggcgtg
acatccgcctttgccaatctggtccttcttggcctcccgctgatcgccggcatctacggg
cccgagggcctcttgttgctgagcctgatcatctccatccatctggtgatcctgatggct
gtgtcgatgttgttgttcgaatgggcgcagcacaaggatggagtgtcgaagggctcgatc
gggatcgtcgctttcgtgcgcagcttcggcctgcaactcatccgaaacccgctgatcgtc
ggcattctctgcgggctgatcgggcgcctgatcggcctcgaactgccttcgctcggcagc
cgtctcgtcaacagcctcgccgatatcgcagcccccctggcgcttttcgccatgggcatg
agcctgcgcaatttcggacttgccggacacctgatgcccgccgcagcgctgaccttcctc
aagctgatggtgatgcccacggttgtccttgtcatggcgcttatcttggatttgccaccg
ctaaccgcgcaggtcgccgtcgtctcggcctcgatgcccgcaggcgtcaattcctggctg
atcgccaacaagttcaacaccggccagcgcctcgcctcgacggccatgacaatgtcgacg
ccgctggcggttttgtcgacgctcttctgggttttcgtcgcagcccatgtcttcggcggc
tga
DBGET
integrated database retrieval system