Trichophyton benhamiae: ARB_03020 Help Entry ARB_03020         CDS       T01611                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism abe  Trichophyton benhamiae Pathway abe03020   RNA polymerase abe03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:abe00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     ARB_03020   09124 Replication and repair    03420 Nucleotide excision repair     ARB_03020  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:abe03021]     ARB_03020    03400 DNA repair and recombination proteins [BR:abe03400]     ARB_03020 Transcription machinery [BR:abe03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      ARB_03020   RNA polymerase III system    RNA polymerase III      ARB_03020   RNA polymerase I system    RNA polymerase I      ARB_03020 DNA repair and recombination proteins [BR:abe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       ARB_03020 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  9525589 NCBI-ProteinID:  XP_003010319 UniProt:  D4B3I1 LinkDB All DBs AA seq 146 aa AA seqDB search MSDPILFEDTFSITSINAQKYDRVSRISCTSTDHLITFTLDVNTEIYPCAPGESLSLALA STLALDGKEEATGERAVWRDVGMGENTLANDYDYVCYGKVYRFEESSTAGNMAVFVSFGG LLLYLDGPYNKLSPLKIDYVYLLMKK NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgtcggatccgatcctgttcgaagacaccttcagcatcacctcgatcaacgctcagaaa tatgaccgtgtctcgcgcatcagctgtacatctacagaccatctgatcaccttcaccctg gatgtgaacacggaaatctatccatgcgcccccggagagtcgctgtcgctggctctggcg tcgacattggcactggatggcaaggaagaagcaaccggtgagagagctgtatggagagat gtaggcatgggggagaacactctggcaaatgactacgactatgtctgctatggaaaagtt tacagatttgaggagagcagcacggcgggcaatatggctgtcttcgtctccttcggcggt cttttgctatatcttgatgggccatacaacaagctcagcccacttaaaattgactacgtc tatcttctcatgaagaagtag

DBGET integrated database retrieval system