Trichophyton benhamiae: ARB_05686 Help Entry ARB_05686         CDS       T01611                                  Name (RefSeq) hypothetical protein   KO K05754   actin related protein 2/3 complex, subunit 5 Organism abe  Trichophyton benhamiae Pathway abe04138   Autophagy - yeast abe04144   Endocytosis abe04517   IgSF CAM signaling abe04519   Cadherin signaling abe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:abe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     ARB_05686    04519 Cadherin signaling     ARB_05686  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     ARB_05686    04138 Autophagy - yeast     ARB_05686  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     ARB_05686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:abe04131]     ARB_05686   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:abe04812]     ARB_05686 Membrane trafficking [BR:abe04131]  Others   Actin-binding proteins    Arp2/3 complex     ARB_05686 Cytoskeleton proteins [BR:abe04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Arp2/3 complex      ARB_05686 SSDB OrthologParalogGFIT Motif Pfam:  P16-Arc Motif Other DBs NCBI-GeneID:  9524359 NCBI-ProteinID:  XP_003016287 UniProt:  D4AN81 LinkDB All DBs AA seq 143 aa AA seqDB search MPQITNYRTIDIDSLDPESPANFPISSLLPSNLPPPTTSSAAASLASQIRQLLRSGDTEG ALRHVLDSAPLGGDDRAKEVHLASVVEVLQGIRQTEMTKVLEAVCNGEGGAERGDCLMKY LYVDIYLLHMSLMPFLFNCLQAE NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgccacagataacaaactacagaaccattgatatcgacagccttgacccggagtcgcct gccaatttcccgatttcttctctacttccttcaaacctaccgccgccaacaacgtccagc gcggcagcaagccttgcatcacagatcagacagttgcttcgatctggggacacagaagga gctttacgccatgttctcgattcagctccgctaggtggcgatgacagggcaaaggaggtt catcttgcttcggttgtggaggttttacagggtatacggcagacggagatgacaaaagtg ctggaagcagtatgtaacggtgaaggaggcgctgaacggggggattgtctgatgaagtac ctgtacgtcgacatatacctcctccatatgtccctcatgcctttccttttcaactgcctt caggcagagtaa

DBGET integrated database retrieval system