Trichophyton benhamiae: ARB_06761 Help Entry ARB_06761         CDS       T01611                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism abe  Trichophyton benhamiae Pathway abe03083   Polycomb repressive complex abe04111   Cell cycle - yeast abe04120   Ubiquitin mediated proteolysis abe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:abe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     ARB_06761    04120 Ubiquitin mediated proteolysis     ARB_06761   09126 Chromosome    03083 Polycomb repressive complex     ARB_06761  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     ARB_06761  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:abe04131]     ARB_06761    04121 Ubiquitin system [BR:abe04121]     ARB_06761    03036 Chromosome and associated proteins [BR:abe03036]     ARB_06761 Membrane trafficking [BR:abe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     ARB_06761 Ubiquitin system [BR:abe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      ARB_06761    Cul7 complex      ARB_06761 Chromosome and associated proteins [BR:abe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      ARB_06761   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      ARB_06761 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  9520724 NCBI-ProteinID:  XP_003015001 UniProt:  D4ARL8 LinkDB All DBs AA seq 164 aa AA seqDB search MASTATNKITLTSSDGVEVTIERQVAERSILIKNMLEDLGDSGEPIPIPNVNESVLKKVI EWCEHHKGDPPSTGDDDVDSRRKTTDIDEWDQKFMQVDQEMLFEIILAANYLDIKALLDV GCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEE NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggcttccactgcgaccaacaagatcaccttgaccagctccgatggcgttgaagtcact atcgaacgccaggtagctgagcgctccatcttgatcaagaacatgctcgaggatctcggc gactccggcgaacccattcctattcccaacgtcaacgagtctgttctcaagaaagtcatc gagtggtgtgagcaccacaagggcgaccccccaagcaccggtgacgatgacgtcgactcc cgccgcaagaccaccgacatcgacgagtgggaccagaagttcatgcaggtcgaccaggag atgctcttcgaaatcattctcgctgccaactacctcgacatcaaggccttgctcgacgtt ggatgcaaaaccgtcgcaaacatgatcaagggcaagtcccccgaggagatccgcaagacc tttaacatccagaacgacttcactccagaagaagaggaccagattcgccgtgagaacgag tgggctgaagagtaa

DBGET integrated database retrieval system