Acinetobacter bereziniae: BSR55_16105 Help Entry BSR55_16105       CDS       T06609                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism aber  Acinetobacter bereziniae Pathway aber00361   Chlorocyclohexane and chlorobenzene degradation aber00362   Benzoate degradation aber00623   Toluene degradation aber01100   Metabolic pathways aber01120   Microbial metabolism in diverse environments aber01220   Degradation of aromatic compounds Module aber_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aber00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BSR55_16105    00361 Chlorocyclohexane and chlorobenzene degradation     BSR55_16105    00623 Toluene degradation     BSR55_16105 Enzymes [BR:aber01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      BSR55_16105     1.14.13.244  phenol 2-monooxygenase (NADH)      BSR55_16105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  ATZ64756 LinkDB All DBs Position 3406913..3407275 Genome browser AA seq 120 aa AA seqDB search MTVKAIVENYQFEPLDLQQKYGDNMLLFIGWDHHTLFCSAHTFVVSAHQTFQELLDGQIQ VGFEQHPDFANIDWSKVEFYLNQQRLNVDFSKSLADLGFDHKSLLRFVTPELQGYNGTHV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaccgtaaaagcgattgtagaaaattatcaatttgaacctttagatctccagcaaaaa tacggcgacaatatgctgctatttattggttgggaccatcatacacttttttgttctgcc catacttttgtcgtttcagctcatcaaacttttcaagagttgcttgatggacagattcaa gtaggtttcgagcaacatcctgactttgcaaatattgattggtcaaaagttgagttttac cttaaccagcaacggttaaacgtggacttctctaaatcattagcggatttgggttttgat cacaaatcactcctacgctttgttacgcctgaattacagggttacaacggcacacacgtt taa

DBGET integrated database retrieval system