Acinetobacter bereziniae: BSR55_17970 Help Entry BSR55_17970       CDS       T06609                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aber  Acinetobacter bereziniae Pathway aber01100   Metabolic pathways aber01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aber00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSR55_17970    00074 Mycolic acid biosynthesis     BSR55_17970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSR55_17970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  ATZ65080 LinkDB All DBs Position complement(3822956..3823192) Genome browser AA seq 78 aa AA seqDB search MSDIEQRIKQAVAEQLGIKAEEIKNEASFMDDLGADSLDLVELVMSFENDFDITIPDEDS NEITTVQSAIDYVTKKLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgagcgatatcgaacaacgcattaaacaagctgttgcagaacaattaggtattaaagct gaagaaatcaaaaacgaagcatctttcatggatgatttgggtgcggattctttagaccta gtagaacttgttatgtctttcgaaaatgacttcgacatcactattcctgatgaagattct aacgaaatcacgactgttcaatcagcaatcgactatgtaactaaaaaacttggttaa

DBGET integrated database retrieval system