Aeromonas bestiarum: IU367_00610 Help Entry IU367_00610       CDS       T08822                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism abes  Aeromonas bestiarum Brite KEGG Orthology (KO) [BR:abes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:abes03036]     IU367_00610 (zapB) Chromosome and associated proteins [BR:abes03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     IU367_00610 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF7491 DUF2046 NET2A HR1 TSC22 NUDE_C Nuf2_DHR10-like K-box Uso1_p115_C XRCC4_CC DUF7603 DivIC TolA_bind_tri Mod_r CCDC138_cc ACBP4_C DUF6262 CtIP_N Rootletin FliT RAP1 PDDEXK_12 bZIP_2 DUF6212 Herpes_UL6 DIMCO_N bZIP_1 Spc24 FlaC_arch Cep57_CLD_2 HALZ Motif Other DBs NCBI-ProteinID:  WDL82769 LinkDB All DBs Position 133015..133224 Genome browser AA seq 69 aa AA seqDB search MSLEVLEQLESKVQSAVDNISLLKMELDELKEQNGKLQDENHQLRNEHVAWQERLRALLG KMDQMGETI NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtcactagaagtccttgagcaactcgaatccaaagtacaatccgccgtcgacaacatc tctctgctgaagatggagctggacgagctgaaagagcaaaacggcaagctgcaagacgaa aaccatcaactgcgcaacgaacacgttgcctggcaggaacgtctgcgcgccctgctgggc aagatggatcagatgggcgaaaccatctag

DBGET integrated database retrieval system