Azospirillum brasilense Sp 7: AMK58_11185 Help Entry AMK58_11185       CDS       T04566                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism abf  Azospirillum brasilense Sp 7 Pathway abf01100   Metabolic pathways abf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMK58_11185    00074 Mycolic acid biosynthesis     AMK58_11185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMK58_11185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALJ35934 UniProt:  A0A560C1J5 LinkDB All DBs Position complement(2420295..2420555) Genome browser AA seq 86 aa AA seqDB search MEKLERELKTLIVDALKLEDIAPEEIDSEEPLFNDGLGLDSIDALELGVALRKAYGIKIE SVTDDVKQHFANVRSLARFIQSQRAE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggaaaagcttgaacgtgagttgaagaccttgattgttgacgcgctcaagctggaagac attgccccagaagagattgacagcgaggaaccgctcttcaacgacgggctgggcctcgat tccatcgacgcattggaattgggcgtcgcgctgcgcaaggcttacggcatcaagatcgaa tccgtgaccgacgacgtgaagcagcacttcgccaacgtgcgctcccttgcccgcttcatt caatcccagcgtgcggagtaa

DBGET integrated database retrieval system