Azospirillum brasilense Sp 7: AMK58_16825 Help Entry AMK58_16825       CDS       T04566                                  Name (GenBank) preprotein translocase   KO K03116   sec-independent protein translocase protein TatA Organism abf  Azospirillum brasilense Sp 7 Pathway abf03060   Protein export abf03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:abf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AMK58_16825  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AMK58_16825  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:abf02044]     AMK58_16825 Secretion system [BR:abf02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AMK58_16825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Motif Other DBs NCBI-ProteinID:  ALJ37160 UniProt:  A0A0P0FC28 LinkDB All DBs Position ABSP7_p1:675584..675877 Genome browser AA seq 97 aa AA seqDB search MGFSSVWHWVIVLLIVLLLFGAGKLPKVMGDLAKGIKNFKAGLKDEEEGTAAGADSKVLP NQPVPPAQPVSSVHPVPPAPVPPVADPGVKKDETART NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgggattctccagcgtctggcattgggtcatcgtccttctgatcgtccttctcctgttc ggcgccggcaagctgccgaaggtcatgggcgacctcgccaagggcatcaagaacttcaag gccggcctgaaggacgaggaagagggtaccgctgcgggcgccgattccaaggtcctgccg aaccagccggttccgccggcccagccggtgtcctcggtccatccggttccgcccgccccg gttccgcccgtcgccgaccccggcgtgaagaaggacgagacggcccgcacctga

DBGET integrated database retrieval system