Azospirillum brasilense Sp 7: AMK58_18315 Help Entry AMK58_18315       CDS       T04566                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism abf  Azospirillum brasilense Sp 7 Pathway abf01100   Metabolic pathways abf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMK58_18315    00074 Mycolic acid biosynthesis     AMK58_18315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMK58_18315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALJ37419 UniProt:  A0A0N7I8I9 LinkDB All DBs Position ABSP7_p1:complement(1009432..1009665) Genome browser AA seq 77 aa AA seqDB search MNRKDFLLALDEMLELDPGTLTGAEELDSIDAWDSLAVISFIALVDEKLGHVVEGEKLVR AKTVEDLIGLAGIAVAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcaaggatttcctgcttgcgctcgacgagatgctggagctggaccccggcacg ctgacgggggcggaagaactcgactcgatcgacgcctgggactcgctggccgtcatcagc ttcatcgcgctggtcgacgagaagctcggccacgtcgtggagggcgagaagctcgtcagg gcgaagacggtggaggacctgatcggtctggccggcatcgccgtggccgcctga

DBGET integrated database retrieval system