Asaia bogorensis: Asbog_00748
Help
Entry
Asbog_00748 CDS
T04138
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
abg
Asaia bogorensis
Pathway
abg03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
abg00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Asbog_00748 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
abg03011
]
Asbog_00748 (rplR)
Ribosome [BR:
abg03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Asbog_00748 (rplR)
Bacteria
Asbog_00748 (rplR)
Archaea
Asbog_00748 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
BAT19043
UniProt:
A0AAN4U2L5
LinkDB
All DBs
Position
820273..820635
Genome browser
AA seq
120 aa
AA seq
DB search
MATQHGLQERRRQRLRFQLRRKSGGRPRLSVFRSGKNIYAQVIDDAQGVTLASASTLEKT
LRESGKTGANVDAASVVGKLVAERALAAGVTAVVFDRGAYLYHGRVKALAEAAREGGLSF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atggctacgcagcatggattgcaggaacggcgccgtcagcggcttcgcttccagcttcgc
cgcaagagcggtggccggccgcgtctgtcggtcttccgttctggcaagaacatctacgca
caggtgatcgacgacgcccagggcgttaccctcgccagcgcttccaccctcgagaagact
cttcgcgagtccggcaagacgggtgcaaatgtcgatgcggcttcggttgtcggcaagctg
gttgcagagcgcgctctggccgctggcgtgacggcggtcgtgttcgatcgcggtgcgtat
ctctatcatggtcgcgtcaaggcgctggccgaagctgcccgcgagggcggcctttcgttc
taa
DBGET
integrated database retrieval system