KEGG   Asaia bogorensis: Asbog_00748
Entry
Asbog_00748       CDS       T04138                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
abg  Asaia bogorensis
Pathway
abg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:abg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Asbog_00748 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:abg03011]
    Asbog_00748 (rplR)
Ribosome [BR:abg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Asbog_00748 (rplR)
  Bacteria
    Asbog_00748 (rplR)
  Archaea
    Asbog_00748 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: BAT19043
UniProt: A0AAN4U2L5
LinkDB
Position
820273..820635
AA seq 120 aa
MATQHGLQERRRQRLRFQLRRKSGGRPRLSVFRSGKNIYAQVIDDAQGVTLASASTLEKT
LRESGKTGANVDAASVVGKLVAERALAAGVTAVVFDRGAYLYHGRVKALAEAAREGGLSF
NT seq 363 nt   +upstreamnt  +downstreamnt
atggctacgcagcatggattgcaggaacggcgccgtcagcggcttcgcttccagcttcgc
cgcaagagcggtggccggccgcgtctgtcggtcttccgttctggcaagaacatctacgca
caggtgatcgacgacgcccagggcgttaccctcgccagcgcttccaccctcgagaagact
cttcgcgagtccggcaagacgggtgcaaatgtcgatgcggcttcggttgtcggcaagctg
gttgcagagcgcgctctggccgctggcgtgacggcggtcgtgttcgatcgcggtgcgtat
ctctatcatggtcgcgtcaaggcgctggccgaagctgcccgcgagggcggcctttcgttc
taa

DBGET integrated database retrieval system