Asaia bogorensis: Asbog_01782 Help Entry Asbog_01782       CDS       T04138                                  Symbol groES Name (GenBank) heat shock protein GroES   KO K04078   chaperonin GroES Organism abg  Asaia bogorensis Brite KEGG Orthology (KO) [BR:abg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:abg03110]     Asbog_01782 (groES)    03029 Mitochondrial biogenesis [BR:abg03029]     Asbog_01782 (groES) Chaperones and folding catalysts [BR:abg03110]  Heat shock proteins   HSP10    Asbog_01782 (groES) Mitochondrial biogenesis [BR:abg03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Asbog_01782 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7460 Motif Other DBs NCBI-ProteinID:  BAT20044 UniProt:  A0AAN4R0U7 LinkDB All DBs Position complement(1971241..1971531) Genome browser AA seq 96 aa AA seqDB search MTNFRPLHDRVVVRRLEGEQKTAGGIIIPDTAKEKPMEGEIVSVGPGARNEQGQLVALDV KAGDRVLFGKWSGTEVKINGEELLIMKESDIMGVIG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacaaattttcggcctttgcatgaccgtgtcgtcgttcgccgccttgagggcgagcag aagacggccggtggcatcatcattccggacaccgccaaggaaaagcccatggaaggcgaa atcgtctccgttggtccgggtgcccgcaatgagcagggtcagctggtagcactggacgtc aaggctggcgatcgcgtgctgttcggcaagtggtccggcaccgaggtgaagatcaacggc gaagagctgctgatcatgaaggaaagcgacatcatgggtgtgatcggctga

DBGET integrated database retrieval system