Acinetobacter baumannii TYTH-1: M3Q_763 Help Entry M3Q_763           CDS       T02261                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism abh  Acinetobacter baumannii TYTH-1 Pathway abh01100   Metabolic pathways abh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M3Q_763    00074 Mycolic acid biosynthesis     M3Q_763   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M3Q_763 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFU36855 LinkDB All DBs Position 824107..824367 Genome browser AA seq 86 aa AA seqDB search MSNLADELKQMIIDVLALEDITIADIDTEAPLFGEGLGLDSIDALELGLALKKRYNIHLN AESDETKQHFKSIQSLVALVEAQQKS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcttgctgatgaactaaagcaaatgattattgatgttctagcactagaagat attactattgccgatattgatacagaagctccattatttggagaaggtttaggattagac tcgattgatgcacttgagttgggactggctttgaaaaagcgttacaacattcatttaaat gcagaatcggatgaaactaaacagcattttaagtcaatccagagcttggttgctttagtt gaagcacaacagaagtcataa

DBGET integrated database retrieval system