Aciduliprofundum boonei: Aboo_0564 Help Entry Aboo_0564         CDS       T01180                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism abi  Aciduliprofundum boonei Pathway abi03010   Ribosome Brite KEGG Orthology (KO) [BR:abi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Aboo_0564   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Aboo_0564  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:abi03011]     Aboo_0564    04121 Ubiquitin system [BR:abi04121]     Aboo_0564   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:abi04147]     Aboo_0564 Ribosome [BR:abi03011]  Ribosomal proteins   Eukaryotes    Small subunit     Aboo_0564   Archaea     Aboo_0564 Ubiquitin system [BR:abi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Aboo_0564 Exosome [BR:abi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Aboo_0564   Exosomal proteins of colorectal cancer cells    Aboo_0564 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_Ribbon_1 Zn_ribbon_NrdR Zn_ribbon_Nudix MqsA_antitoxin Cas12f1-like_TNB Ribosomal_L37e HVO_0758 Zn_ribbon_IS1595 GFA Zn_ribbon_3 Zn_ribbon_RPB9 PknG_rubred DUF1936 Zn_ribbon_NUD DZR Zn_ribbon_13 Alsin_RLD Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  ADD08375 UniProt:  B5I9Z2 LinkDB All DBs Position complement(546272..546424) Genome browser AA seq 50 aa AA seqDB search MEKRELYEIKDGKIVRKRRFCPKCGPGVFMAEHEDRYSCGKCGYTEFKKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaagagagttgtatgaaataaaagacggtaaaatcgttcgcaaaaggcgtttt tgcccaaagtgcggtcccggagtttttatggctgagcatgaggatcgctactcttgcggc aaatgcggatatactgaatttaaaaagaaatga

DBGET integrated database retrieval system