KEGG   Akkermansia biwaensis: Abiwalacus_25030
Entry
Abiwalacus_25030  CDS       T08790                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
abiw  Akkermansia biwaensis
Pathway
abiw00770  Pantothenate and CoA biosynthesis
abiw01100  Metabolic pathways
abiw01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:abiw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Abiwalacus_25030 (coaD)
Enzymes [BR:abiw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Abiwalacus_25030 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: BDL44929
UniProt: A0ABM7ZJG7
LinkDB
Position
complement(3113240..3113767)
AA seq 175 aa
MKRIAVYAGSFDPLTNGHLWMIRQGARMFDELIVAIGDNPEKHYTFSHEERMDMLRTALS
DMPEVRIAEFHNRFLVDFAKEHEASFMLRGIRSTQDYEYERVMRHINADMAPKVCTVFLM
PPRDTAELSSSMIKGLIGPEGWESQVSRYVPPNVFALLKKKYKTLTEEMRRQGGQ
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaagcgcatcgccgtgtacgccggtagtttcgaccccctgaccaatggccacttgtgg
atgatcaggcagggggcgcggatgtttgatgagctgattgtggccatcggcgacaatccg
gaaaagcattacacgttttcccatgaagaacgcatggacatgcttcgtacggcgctttcc
gatatgccggaggtccgcattgccgaattccacaaccgctttctggtggactttgccaag
gagcatgaggcctccttcatgctgcgcggcatccgttccactcaggactatgaatatgaa
cgcgtgatgcgccatatcaatgcggatatggctcccaaggtttgtaccgtgttcctgatg
cccccgcgcgatacggcggaattgtcctccagcatgatcaagggcctgatcgggccggaa
ggatgggaaagccaggtgagccgttacgttcccccgaacgtgttcgccctgctcaagaag
aaatataaaaccctgacggaggaaatgcgccggcagggcggccaatag

DBGET integrated database retrieval system