Alcanivorax borkumensis: ABO_0633 Help Entry ABO_0633          CDS       T00380                                  Symbol cpn10, groES Name (GenBank) chaperonin, 10 kDa   KO K04078   chaperonin GroES Organism abo  Alcanivorax borkumensis Brite KEGG Orthology (KO) [BR:abo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:abo03110]     ABO_0633 (cpn10)    03029 Mitochondrial biogenesis [BR:abo03029]     ABO_0633 (cpn10) Chaperones and folding catalysts [BR:abo03110]  Heat shock proteins   HSP10    ABO_0633 (cpn10) Mitochondrial biogenesis [BR:abo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ABO_0633 (cpn10) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  CAL16081 UniProt:  Q0VRW7 LinkDB All DBs Position 699261..699551 Genome browser AA seq 96 aa AA seqDB search MSIRPLHDRVLVRREEEETKSAGGIVLPGSAAEKPSRGEVIAVGNGKITENGDVRPLDVK AGDTVIFGQYSGSTVKVEGEELLIMSEAEILAVVED NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagcatccgtcctttgcatgatcgcgtgctggttcgccgtgaagaggaagaaaccaaa tctgctggcggtattgtgctgcctggttccgctgccgagaagccgtcccgtggtgaagtt atcgccgttggcaatggcaaaatcaccgaaaatggcgatgtgcgtccgctggacgtaaaa gccggtgatacggtgatcttcggccaatactccggcagcaccgtgaaggtggaaggcgaa gagctgctgatcatgagcgaagctgaaattctggccgtcgtcgaagactaa

DBGET integrated database retrieval system