Azospirillum brasilense Az39: ABAZ39_18235 Help Entry ABAZ39_18235      CDS       T03288                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism abq  Azospirillum brasilense Az39 Pathway abq01100   Metabolic pathways abq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABAZ39_18235    00074 Mycolic acid biosynthesis     ABAZ39_18235   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABAZ39_18235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIB13879 UniProt:  A0A2K1FRX7 LinkDB All DBs Position AbAZ39_p1:complement(816468..816701) Genome browser AA seq 77 aa AA seqDB search MDRKEFLLALDEMLELDAGTLTGAEDLESIDSWDSLAVISFIALVDEKLGHVVEGEKLVK AKTVDDLLGLAGIAVAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaccgcaaggaattcctgctcgcgctcgacgagatgctggagctggacgccggcacc ctgacgggcgcggaagacctcgaatcgatcgacagctgggactcgctggccgtcatcagc ttcatcgccctggtcgacgagaagctcggccatgtcgtggagggcgagaagctcgtcaag gcgaagacggtggacgacctgctcggtctggccggcatcgccgtggccgcctga

DBGET integrated database retrieval system