Argiope bruennichi (wasp spider): 129963457 Help Entry 129963457         CDS       T09870                                  Name (RefSeq) centromere protein X-like   KO K15360   centromere protein X Organism abru  Argiope bruennichi (wasp spider) Pathway abru03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:abru00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     129963457  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:abru03400]     129963457 DNA repair and recombination proteins [BR:abru03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      129963457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF Histone PDZ Motif Other DBs NCBI-GeneID:  129963457 NCBI-ProteinID:  XP_055933827 LinkDB All DBs Position 3:63107558..63125583 Genome browser AA seq 87 aa AA seqDB search MSDLSNSEHLKSKCIEKILKLKFKNTNTRMQNDAVKLVTEVVRIFITECAARAAIQAQSE CIGESDIIPEVNNQHLEKILPQLLLDF NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctgatctaagcaattcagaacatcttaaatcaaaatgtattgagaagattttgaaa ttgaaattcaaaaacaccaacacaagaatgcaaaatgatgctgtaaaactagtaacagaa gtggtacggatattcattacagagtgtgctgcaagagctgccattcaagcacagagtgaa tgcattggtgaaagtgatataattcctgaagtgaataaccagcatttagaaaaaattcta cctcagttgctccttgacttctag

DBGET integrated database retrieval system