Argiope bruennichi (wasp spider): 129968994 Help Entry 129968994         CDS       T09870                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism abru  Argiope bruennichi (wasp spider) Pathway abru04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:abru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129968994  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:abru04121]     129968994    03400 DNA repair and recombination proteins [BR:abru03400]     129968994 Ubiquitin system [BR:abru04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129968994    Cul5 complex      129968994 DNA repair and recombination proteins [BR:abru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129968994 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  129968994 NCBI-ProteinID:  XP_055939361 LinkDB All DBs Position 5:20414865..20415553 Genome browser AA seq 114 aa AA seqDB search MPDNKEEPVYGGCEGPDAMYVKLISSDGHEFIIKRDYVLTSGTIRAMLSGPGQFSENETN EVNFREIPSHVLQKVCQYFAYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgcctgataataaagaagagcctgtatatggcggctgtgaaggccctgatgctatgtac gtaaaactcatctcttcagatggtcatgaatttattattaagagagattatgttcttaca tctggaaccattcgagccatgttgagtggacctggtcagttttcggagaatgaaacaaat gaagtgaatttcagggaaataccatctcacgtgctgcagaaagtatgccaatactttgca tacaaagttcgttacaccaacagttctactgaaataccagagttccccatcgcgcctgaa attgcattggaattgctgatggcagctaatttcttagattgctaa

DBGET integrated database retrieval system