Malaciobacter canalis: ACAN_0410 Help Entry ACAN_0410         CDS       T06502                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acaa  Malaciobacter canalis Pathway acaa01100   Metabolic pathways acaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACAN_0410 (acpP)    00074 Mycolic acid biosynthesis     ACAN_0410 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACAN_0410 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QEE31915 LinkDB All DBs Position complement(405123..405353) Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVVEQLDCDIAEIKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE GIQTVADAIKYIEEHA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagaagtggtagtagagcaactagattgtgatattgca gagatcaaagaagattctaaatttattgaggatttaggagcggactctttagacgtagtt gaattagttatggctttagaagagaagtttgatatcgaaatccctgatgaagatgcagaa ggtatccaaactgttgctgatgctattaaatacatcgaagagcacgcgtaa

DBGET integrated database retrieval system