Actinoalloteichus fjordicus: UA74_11010 Help Entry UA74_11010        CDS       T04639                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism acad  Actinoalloteichus fjordicus Pathway acad01056   Biosynthesis of type II polyketide backbone acad01100   Metabolic pathways acad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acad00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     UA74_11010    00253 Tetracycline biosynthesis     UA74_11010  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:acad01004]     UA74_11010    01008 Polyketide biosynthesis proteins [BR:acad01008]     UA74_11010 Lipid biosynthesis proteins [BR:acad01004]  Polyketide synthase   Component type    UA74_11010 Polyketide biosynthesis proteins [BR:acad01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      UA74_11010     Nonaketide PKS      UA74_11010     Decaketide PKS      UA74_11010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  APU14262 UniProt:  A0AAC9LAY8 LinkDB All DBs Position 2462300..2462560 Genome browser AA seq 86 aa AA seqDB search MSRFTLEELREIMRTSAGVDEGVDLDSDIGDLEFDELGYDSLAVLEFASIVQRRYGVPIP DDIVTESGTPSKAVHFINTQIEKAGV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaggttcaccctggaggaactgcgggagatcatgcgcaccagcgcaggcgtcgac gagggcgtcgacctggactccgacatcggagacctcgagttcgacgagctgggctacgac tcgctggccgtcctggagttcgccagcatcgtgcagcgccgctacggcgtgccgatcccg gacgacatcgttaccgagtctggaacgccttcgaaggcggtccacttcatcaacacgcag atcgagaaggcaggggtctga

DBGET integrated database retrieval system