Actinoalloteichus fjordicus: UA74_27755
Help
Entry
UA74_27755 CDS
T04639
Name
(GenBank) ATP-dependent DNA helicase PcrA
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
acad
Actinoalloteichus fjordicus
Pathway
acad03420
Nucleotide excision repair
acad03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
acad00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
UA74_27755
03430 Mismatch repair
UA74_27755
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
acad03400
]
UA74_27755
Enzymes [BR:
acad01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
UA74_27755
DNA repair and recombination proteins [BR:
acad03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
UA74_27755
MMR (mismatch excision repair)
Other MMR factors
UA74_27755
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
UvrD_C_2
PcrA_UvrD_tudor
AAA_30
DUF5338
AAA_11
DEAD
Motif
Other DBs
NCBI-ProteinID:
APU17552
UniProt:
A0AAC9LIW7
LinkDB
All DBs
Position
complement(6539812..6542301)
Genome browser
AA seq
829 aa
AA seq
DB search
MNTLFELSPDASTSAPARRAVDSAALLAGLNPQQHQAVTHQGSPLLVVAGAGSGKTRVLT
SRIGYLLAERDVHPGQILAITFTNKAAAEMKERVADLVGPRANLMWVSTFHSMCARLLRR
EARTLRELLAGDDSAGTANSNFSIYDGDDAKRLITQVARDLELDPKRFPARTLAVHISNL
KNELIGPVEAAEQAADELQRRVAQVYAAYQRRLHSSNALDFDDLILRSVELLQRFPDVAG
YYRRRFRHVMVDEYQDTNHAQYVLVRELVGAATGDQGPAVPPAELCVVGDADQSIYAFRG
ATIRNIVEFERDYPDARTIMLEQNYRSTQTILSAANAVISRNPDRRDKRLWTDSGEGEKI
VGYVADNEHDEAAFVAREIDRLVDAGEVVNGDIAVFYRTNNQSRVFEEIFIRLGLPYRVV
GGVRFYERREVRDALAYLRALANPDDAVGLRRILNTPKRGIGDRAEAVISVYAEQQEIGF
APALRAAAEGRVALLNSRSQKAVAGFVALMDELRAELDAGHDVAEILEAVLERTGYRATL
EDSDDPQDASRLENLTELVTVAREFVAQALAVENEAAPVSQETAEPLSTSTDADADAEDG
PPAGSLAAFLERVALVADSDSVPESEDGVVTLMTLHTAKGLEFPVVFCTGWEDGIFPHLR
ALGDPAEAAEERRLAYVGITRARERLYLSRALVRSAWGQPMTNPASRFLEEIPTDLIDWR
RLAPDRSAPSVATRWGGRSGSGFGSDSAQAAVAQGGMKTTGFGGFGRGGAANAVPMKLDV
GDRVSHDKYGLGKVVATDGSGPRTTATIDFGTAGRVKLMLIGSVPMTKL
NT seq
2490 nt
NT seq
+upstream
nt +downstream
nt
atgaacaccctgttcgagctttccccagacgcgtccacctcggctccggcgcggcgcgcc
gtcgactcggcggccctgctggcgggactcaatccgcagcagcaccaggccgtgacccat
cagggcagcccgctgctggtggtggcgggcgccggatcgggaaagacgcgggtgctgacc
agccgcatcggttatctgcttgctgagcgtgacgtccaccctggtcagatcctggcgatc
accttcaccaacaaggccgccgcggagatgaaggaacgcgtcgcagatctggtcggcccc
cgagccaatctgatgtgggtctccaccttccactcgatgtgcgcgcgactgctgcggcgc
gaggcgaggaccctgcgggagctgctggcaggcgacgactcggcaggcaccgcgaactcg
aacttctccatctacgacggcgacgacgccaagcggctgatcacccaggtcgcccgtgat
ctggaactggaccccaagcggttcccggctcggacgctggccgtgcacatctccaatctg
aagaacgagctgatcgggcctgtggaggccgcagaacaggccgccgacgagctgcaacgg
cgggtggcgcaggtctatgccgcctatcagcgccgactgcactccagcaacgccctggac
ttcgacgacctgatcctgcgctcggtcgagctgttgcagcggttccccgacgtcgcgggc
tactaccggcgtcgcttccggcacgtcatggtcgacgagtatcaggacaccaaccacgcc
cagtacgtgttggtgcgcgagctggtcggcgcggccaccggggatcagggccctgcggtg
ccgcccgcggaactgtgcgtggtcggcgacgcggaccagtcgatctacgccttccgaggc
gccacgattcgcaacatcgtcgagttcgagcgcgactacccggacgcgcggacgatcatg
ctggagcagaactaccgctcgacgcagacgatcctctccgcggccaacgccgtgatctcc
cgcaacccggatcggcgggacaagcggctgtggaccgactccggcgagggcgagaagatc
gtcggctacgtcgcggacaacgaacatgacgaggcggcgttcgtcgccagggagatcgat
cggctggtcgacgcgggcgaggtcgtcaacggcgacatcgcggtcttctaccggaccaac
aaccagtcccgggtcttcgaggagatcttcatccggctcggcctgccgtatcgcgtggtc
ggcggcgtccggttctacgagcgtcgtgaggtccgcgatgcgctggcctacctgcgcgcg
ctggcgaacccggacgacgccgtggggctccggcgcatcctcaacacccccaagcgcggc
atcggggaccgggcggaggcggtcatctcggtgtacgccgagcagcaggagatcggcttc
gctccggcgctgcgagccgcagccgaggggcgggtcgccctgctcaactcgcggtcgcag
aaggccgtcgccggcttcgtggcgttgatggacgagttgcgagccgaactcgacgcgggc
cacgacgtcgccgagatcctcgaagccgtgttggagcgcaccggctaccgcgccacgctg
gaggacagcgacgatccgcaggacgcctcgcggttggagaacctgaccgaactggtcacg
gtggcgcgggagttcgtcgcgcaggcactggcggtcgagaacgaggccgcaccggtgtcc
caggagacggccgagccgctgagcacgtcgaccgatgccgacgcggacgccgaggacgga
ccgcccgcaggctcgctggccgccttcctggaacgggtcgcgctggtggccgactccgat
tccgtgccggagtccgaggacggcgtggtcacgttgatgaccctgcacacggccaagggc
ctggagttcccggtggtgttctgcaccggctgggaggacgggatcttcccgcacctgcgg
gcgctgggtgatccggccgaggcagcggaggagcgcaggctcgcgtacgtcggcatcacc
agggcgcgggagcggttgtacctgtcgcgggcgctggtgcgctcggcctggggacagccg
atgaccaacccggcgtcccggttcctggaggagatcccgacggacctgatcgactggcgc
cgccttgccccggaccgctccgcaccgagcgtggcgacccgctggggcggccggtccggc
tcgggattcggctccgactccgcgcaggccgccgtggcccagggcgggatgaagaccacc
ggattcggcggcttcgggcggggcggcgcggccaacgcggtgccgatgaagctcgacgtc
ggcgatcgggtcagccacgacaagtacgggctcggcaaagtggtcgccaccgacggcagc
ggcccgaggaccaccgccaccatcgacttcggcacggcgggccgggtgaagctcatgctc
atcggcagcgttccgatgacgaagttgtag
DBGET
integrated database retrieval system