Thermaerobacillus caldiproteolyticus: ISX45_03920 Help Entry ISX45_03920       CDS       T06899                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism acai  Thermaerobacillus caldiproteolyticus Pathway acai02024   Quorum sensing acai03018   RNA degradation Brite KEGG Orthology (KO) [BR:acai00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ISX45_03920 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ISX45_03920 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:acai03019]     ISX45_03920 (hfq)    03036 Chromosome and associated proteins [BR:acai03036]     ISX45_03920 (hfq) Messenger RNA biogenesis [BR:acai03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ISX45_03920 (hfq) Chromosome and associated proteins [BR:acai03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ISX45_03920 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF5608 Motif Other DBs NCBI-ProteinID:  QPA32151 LinkDB All DBs Position 757553..757777 Genome browser AA seq 74 aa AA seqDB search MKNSINIQDQFLNQLRKDGTQVTVFLLNGFQLRGFVKGFDNFTVLLEVQGKQQLIYKHAI STFAPEKNVQFETE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaaaattcaattaacattcaagaccaatttttaaaccaattgcgtaaggatggcaca caagtaactgtatttttgcttaatggctttcaacttcgcggctttgtaaaagggtttgat aattttacggttcttttggaagtacaaggcaaacagcagcttatttataagcatgctatt tctacgtttgccccagaaaagaatgttcagtttgaaactgaataa

DBGET integrated database retrieval system