Aristolochia californica: 137946164 Help Entry 137946164         CDS       T10486                                  Name (GenBank) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism acak  Aristolochia californica Pathway acak04814   Motor proteins Brite KEGG Orthology (KO) [BR:acak00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     137946164  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acak03037]     137946164    04812 Cytoskeleton proteins [BR:acak04812]     137946164 Cilium and associated proteins [BR:acak03037]  Motile cilia and associated proteins   Dynein arm    137946164 Cytoskeleton proteins [BR:acak04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137946164 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137946164 NCBI-ProteinID:  XP_068648476 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MLEGKALVQDTDMPVKMQIQAMTYASQALDLFDVCDCKSIARHIKREFDKTYGSGWQCVV GSNFGCYFTHSQGTFIYFCLETLNFLIFKGAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaagctcttgtccaagacacagacatgcccgtgaaaatgcagattcaa gccatgacttatgcctcccaagctctcgatctcttcgacgtctgcgactgcaagagcatt gcacgtcacataaaacgggaatttgacaagacctacggatcaggatggcaatgtgttgtg ggatcaaatttcggttgctatttcactcattctcagggaacttttatctacttctgtttg gagaccctcaattttctcatcttcaaaggggcctcctga

DBGET integrated database retrieval system