Aristolochia californica: 137946164 Help Entry 137946164         CDS       T10486                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism acak  Aristolochia californica Pathway acak04145   Phagocytosis acak04517   IgSF CAM signaling acak04814   Motor proteins Brite KEGG Orthology (KO) [BR:acak00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137946164  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137946164   09142 Cell motility    04814 Motor proteins     137946164  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acak03037]     137946164    04812 Cytoskeleton proteins [BR:acak04812]     137946164 Cilium and associated proteins [BR:acak03037]  Motile cilia and associated proteins   Dynein arm    137946164 Cytoskeleton proteins [BR:acak04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137946164 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137946164 NCBI-ProteinID:  XP_068648476 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MLEGKALVQDTDMPVKMQIQAMTYASQALDLFDVCDCKSIARHIKREFDKTYGSGWQCVV GSNFGCYFTHSQGTFIYFCLETLNFLIFKGAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggaaaagctcttgtccaagacacagacatgcccgtgaaaatgcagattcaa gccatgacttatgcctcccaagctctcgatctcttcgacgtctgcgactgcaagagcatt gcacgtcacataaaacgggaatttgacaagacctacggatcaggatggcaatgtgttgtg ggatcaaatttcggttgctatttcactcattctcagggaacttttatctacttctgtttg gagaccctcaattttctcatcttcaaaggggcctcctga

DBGET integrated database retrieval system