Aristolochia californica: 137956817 Help Entry 137956817         CDS       T10486                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism acak  Aristolochia californica Pathway acak04145   Phagocytosis acak04517   IgSF CAM signaling acak04814   Motor proteins Brite KEGG Orthology (KO) [BR:acak00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137956817  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137956817   09142 Cell motility    04814 Motor proteins     137956817  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acak03037]     137956817    04812 Cytoskeleton proteins [BR:acak04812]     137956817 Cilium and associated proteins [BR:acak03037]  Motile cilia and associated proteins   Dynein arm    137956817 Cytoskeleton proteins [BR:acak04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137956817 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF5005 PRAI Ground-like Orexin_rec2 Motif Other DBs NCBI-GeneID:  137956817 NCBI-ProteinID:  XP_068660552 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MSEDSRRSRGKVSPDDRKALGTGAPARKVTVKSADMKEDMQKKAIDCALAAVEKHNVEKD IAEYIKKEFDEKYGATWHCIVGRNFGSYVTHETDHFVYFYLDQKAILLFKSG NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtcggaggacagcaggagaagtagaggcaaggtgtccccggacgaccgcaaggcgttg ggaactggtgccccagcgcggaaagtcaccgttaagagtgccgatatgaaagaggacatg cagaaaaaggctattgactgcgctctcgcggctgttgagaagcataatgtggagaaggac atagctgagtacatcaagaaggagttcgatgagaagtacggcgccacctggcattgcatc gttggtcgcaatttcggatcatacgttacccatgagacagaccactttgtgtacttctat ttggaccaaaaggcaatcttgttattcaagtcggggtga

DBGET integrated database retrieval system