Acinetobacter calcoaceticus: BUM88_02515 Help Entry BUM88_02515       CDS       T05452                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acal  Acinetobacter calcoaceticus Pathway acal00998   Biosynthesis of various antibiotics acal01100   Metabolic pathways acal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BUM88_02515    00074 Mycolic acid biosynthesis     BUM88_02515   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BUM88_02515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD FERM_f0 Motif Other DBs NCBI-ProteinID:  AQZ80585 LinkDB All DBs Position 525554..525802 Genome browser AA seq 82 aa AA seqDB search MLSQEQVLTKLREWMEDLFEIEPESVQLDSNLYSDLDVDSIDAVDLVVKIKELTGKQVKP EDFKNVRTVLDVVTVIRNMTAE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgttatctcaagagcaagtattaactaaactccgcgaatggatggaagatttgtttgaa attgaaccggagtctgttcaactcgattcaaacttatattcagatcttgatgtagacagt attgatgcagttgatttagttgtaaaaattaaagagttaacgggtaagcaagtaaaacct gaagattttaaaaatgtgcgaactgtacttgatgtcgtgacggttattcggaatatgact gctgaatga

DBGET integrated database retrieval system