Acaryochloris sp. 'Moss Beach': HRE53_16805
Help
Entry
HRE53_16805 CDS
T09726
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
acam
Acaryochloris sp. 'Moss Beach'
Pathway
acam00770
Pantothenate and CoA biosynthesis
acam01100
Metabolic pathways
acam01240
Biosynthesis of cofactors
Module
acam_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
acam00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
HRE53_16805 (coaD)
Enzymes [BR:
acam01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
HRE53_16805 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Rogdi_lz
Motif
Other DBs
NCBI-ProteinID:
UJB68231
LinkDB
All DBs
Position
complement(3659051..3659584)
Genome browser
AA seq
177 aa
AA seq
DB search
MIAVYPGSFDPITLGHLDIIERGCNLFGSVIVAVARNPNKAPLFSVQQRLQQIQTCTQHL
TNLELDTFDTLTVTYTQKRKAQVLLRGLRALSDFEYELQMAHTNHTLSPHIETVFLATSN
EYSFLSSSLVKEIAKFGGSVSHLVPENVAIELEECFTKTPPSVSIPPPTAPITPPTD
NT seq
534 nt
NT seq
+upstream
nt +downstream
nt
atgattgcagtctatcctggcagttttgaccccattactttagggcatctcgacattatt
gagcgaggatgcaacttgtttggatcagtcattgttgccgtagctcgcaatcccaacaaa
gcacctttgttttcggttcaacaacgccttcagcaaattcaaacctgtacccagcacctt
accaatttagagcttgacacatttgatacactaacagtgacttatacgcagaagcggaaa
gctcaggtgttattgcggggtctgagagcgttatccgatttcgagtatgagctgcaaatg
gctcataccaaccacaccttatctccccatatcgaaaccgtgtttctggccacctccaac
gaatatagttttctcagcagtagcttagtcaaagagattgctaagtttggtggatcagtt
tctcatcttgttcctgaaaacgttgccattgagttagaagaatgcttcaccaagactccg
ccttcagtgtcgataccaccgccaacagcaccgattacaccacccacggactag
DBGET
integrated database retrieval system