KEGG   Acaryochloris sp. 'Moss Beach': HRE53_16805
Entry
HRE53_16805       CDS       T09726                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
acam  Acaryochloris sp. 'Moss Beach'
Pathway
acam00770  Pantothenate and CoA biosynthesis
acam01100  Metabolic pathways
acam01240  Biosynthesis of cofactors
Module
acam_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:acam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HRE53_16805 (coaD)
Enzymes [BR:acam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     HRE53_16805 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Rogdi_lz
Other DBs
NCBI-ProteinID: UJB68231
LinkDB
Position
complement(3659051..3659584)
AA seq 177 aa
MIAVYPGSFDPITLGHLDIIERGCNLFGSVIVAVARNPNKAPLFSVQQRLQQIQTCTQHL
TNLELDTFDTLTVTYTQKRKAQVLLRGLRALSDFEYELQMAHTNHTLSPHIETVFLATSN
EYSFLSSSLVKEIAKFGGSVSHLVPENVAIELEECFTKTPPSVSIPPPTAPITPPTD
NT seq 534 nt   +upstreamnt  +downstreamnt
atgattgcagtctatcctggcagttttgaccccattactttagggcatctcgacattatt
gagcgaggatgcaacttgtttggatcagtcattgttgccgtagctcgcaatcccaacaaa
gcacctttgttttcggttcaacaacgccttcagcaaattcaaacctgtacccagcacctt
accaatttagagcttgacacatttgatacactaacagtgacttatacgcagaagcggaaa
gctcaggtgttattgcggggtctgagagcgttatccgatttcgagtatgagctgcaaatg
gctcataccaaccacaccttatctccccatatcgaaaccgtgtttctggccacctccaac
gaatatagttttctcagcagtagcttagtcaaagagattgctaagtttggtggatcagtt
tctcatcttgttcctgaaaacgttgccattgagttagaagaatgcttcaccaagactccg
ccttcagtgtcgataccaccgccaacagcaccgattacaccacccacggactag

DBGET integrated database retrieval system