Acanthamoeba castellanii: ACA1_218380 Help Entry ACA1_218380       CDS       T02667                                  Name (RefSeq) polyubiquitin, putative   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism acan  Acanthamoeba castellanii Pathway acan03010   Ribosome acan04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:acan00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     ACA1_218380   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     ACA1_218380  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:acan03011]     ACA1_218380    04121 Ubiquitin system [BR:acan04121]     ACA1_218380 Ribosome [BR:acan03011]  Ribosomal proteins   Eukaryotes    Large subunit     ACA1_218380   Archaea     ACA1_218380 Ubiquitin system [BR:acan04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    ACA1_218380 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_4 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  14915794 NCBI-ProteinID:  XP_004337207 UniProt:  L8GPU6 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MEIFVKTRIGLNMTLDVESSDTIEEVKWKIRGKSGFLPYQQCLVFAGQKLQDDRTLADYQ IPNEATIFLPTLLRGG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggagatctttgtgaagacccgcattggcttgaacatgacgcttgacgttgagtccagc gacaccatcgaggaggtgaagtggaagattcggggcaagtcgggcttccttccctaccag cagtgccttgtcttcgccggccagaagctccaggacgaccgcaccctcgccgactaccag attccaaatgaggccaccatcttcctccccacgcttcttcgcggtggctaa

DBGET integrated database retrieval system